| Desktop | 55/100 | ❗ |
| Mobile | 13/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 119 KB | ✔ |
| Compression | 26 KB (-78.5%) | ✔ |
| Text/Html Ratio | 3346 / 122190 (bytes) = 2.74% | ❗ |
| Load Time | 1.07 second | ✘ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 21 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | Unknown | ✘ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | Yes | ✘ |
| Underscores in url | No | ✔ | Images Without ALT | 1 / 16 | ❗ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| embroidered | 12 | ✘ | ✘ | ✘ |
| sweat | 6 | ✘ | ✘ | ✘ |
| free | 5 | ✘ | ✘ | ✘ |
| store | 5 | ✘ | ✔ | ✘ |
| online | 5 | ✘ | ✘ | ✘ |
| like | 2 | ✘ | ✘ | ✘ |
| white | 2 | ✘ | ✘ | ✘ |
| items | 2 | ✘ | ✘ | ✘ |
| menu | 2 | ✘ | ✘ | ✘ |
| rhinestone | 2 | ✘ | ✘ | ✘ |
| dress | 2 | ✘ | ✘ | ✘ |
| dialog | 2 | ✘ | ✘ | ✘ |
| black | 2 | ✘ | ✘ | ✘ |
| usdaedafnallamdangaoaarsaudawgaznbambbdbdtbgnbhdbifbmdbndbobbrlbsdbtnbwpbynbyrbzdcadcdfchfclfclpcnhcnycopcrccuccupcveczkdjfdkkdopdzdegpernetbeurfjdfkpgbpgelggpghsgipgmdgnfgtqgydhkdhnlhrkhtghufidrilsimpinriqdirriskjepjmdjodjpykeskgskhrkmfkpwkrwkwdkydkztlaklbplkrlrdlsllydmadmdlmgamkdmmkmntmopmromrumurmvrmwkmxnmyrmznnadngnnionoknprnzdomrpabpenpgkphppkrplnpygqarronrsdrubrwfsarsbdscrsdgseksgdshpsllsossrdsspstdstnsvcsypszlthbtjstmttndtoptryttdtwdtzsuahugxuyuuzsvesvndvuvwstxafxcdxofxpfyerzarzmwzwl | 2 | ✘ | ✘ | ✘ |
| categories | 2 | ✘ | ✘ | ✘ |
|
With 1.07 seconds in page load, 119 KB of page size and all other reports below, the womenofclayton.com has a SEO score of 45 out of 100 |
| Title | Home |
| Description | Women of Clayton County webstore. |
| Keyword | women of clayton county,clayton county,women of clayton merchandise,tshirt,tshirtkingatl |
| Age | 0 Years, 5 Days |
| Created | 7th-Sep-2022 |
| Updated | 7th-Sep-2022 |
| Expiry | 7th-Sep-2023 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| womenofclayton.com | A | 3592 | ip:54.154.42.22 |
| womenofclayton.com | NS | 172792 | target:ns1.yoursrs.com |
| womenofclayton.com | NS | 172792 | target:ns2.yoursrs.com |
| womenofclayton.com | SOA | 604800 | mname:ns1.yoursrs.comrname:hostmaster.womenofclayton.comserial:2022090700refresh:1retry:1expire:86400minimum-ttl:604800 |
| womenofclayton.com | MX | 3600 | pri:30target:aspmx3.googlemail.com |
| womenofclayton.com | MX | 3600 | pri:10target:aspmx.l.google.com |
| womenofclayton.com | MX | 3600 | pri:30target:aspmx5.googlemail.com |
| womenofclayton.com | MX | 3600 | pri:20target:alt2.aspmx.l.google.com |
| womenofclayton.com | MX | 3600 | pri:30target:aspmx4.googlemail.com |
| womenofclayton.com | MX | 3600 | pri:30target:aspmx2.googlemail.com |
| womenofclayton.com | MX | 3600 | pri:20target:alt1.aspmx.l.google.com |
| Excessive querying |
| Server IP | 54.154.42.22 |
| Server Location | Ireland |
| Service Provider | AMAZON-02 |
| Domains (TLD) | Status |
|---|---|
| womenofclayton.net | Available |
| womenofclayton.org | Already Registered |
| womenofclayton.biz | Available |
| womenofclayton.io | Already Registered |
| womenofclayton.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| qomenofclayton.com | Available |
| aomenofclayton.com | Available |
| somenofclayton.com | Available |
| domenofclayton.com | Available |
| eomenofclayton.com | Available |
| Landsmensclothing.com |
| Sicoobnetxs.net |
| Qatarorganicfood.com |
| Santioroz.com |
| Darwinplex.com |
| Moneyrovery.com |
| Dimelochile.org |
| Buchornofarm.com |
| Csgogambles.com |
| Ocopcantho.com |